How to send a job/http request in Java(with json) to a webservice which has a submit button? -


i want send http request java programm netmhc webservice results part of pipeline. put sequence json object , try send netmhc service. , start job have click submit button on website. instead of result this, http://www.cbs.dtu.dk/cgi-bin/webface2.fcgi?jobid=5824785e00001e9d3b38e362&wait=20, returns html website of netmhc. how can add submit command json object start job/http request? 

jsonobject obj = new jsonobject(); obj.put("seqpaste", "maalpgtvprmmrpapgqnyprtgfnhirhkiv"); // <textarea name="seqpaste" rows=8 cols=64></textarea> obj.put("len",9);//<select multiple name=len><option value=9>9mer peptides   //add submit button json   //<input type="submit" value="submit">  try (closeablehttpclient httpclient = httpclientbuilder.create().build()) {     httppost request = new httppost("http://www.cbs.dtu.dk/services/netmhc/");      stringentity entity = new stringentity(obj.tojsonstring());     request.addheader("content-type", "application/json");               request.setentity(entity);     httpresponse response = httpclient.execute(request);      string jsonresp = entityutils.tostring(response.getentity(), "utf-8");     system.out.println(jsonresp);  } catch (ioexception ex) {     ex.printstacktrace(); }

are there alternative ways send request webserver has submit button? far tried cgi, turned out have no permission. considered soap, struggeling create correct soap body fits query. have advice me? many in advance


Comments

Post a Comment

Popular posts from this blog

asynchronous - C# WinSCP .NET assembly: How to upload multiple files asynchronously -

i using winscp .net assembly uploading files. want upload multiple files asynchronous way. have created method works single upload. public class uploadingdata { private sessionoptions _sessionoptions; private session _session; //connection etc private void onconnected() { foreach (var fileinfo in localfileslist) { var task = task.factory.startnew(() => uploadfilesasync(fileinfo)); } } private async task uploadfilesasync(string file) { string remotefilepath = _session.translatelocalpathtoremote(file, @"/", "/test_data_upload"); var uploading = _session.putfiles(file, remotefilepath, false); //when done await task.run(() => thread.sleep(1000)); } } please suggest me correct way. thanks you can use backgroundworker class this: string[] images = new string[50]; foreach (var path in images) { backgroundworker
Read more

aws api gateway - SerializationException in posting new Records via Dynamodb Proxy Service in API -

i getting "__type": "com.amazon.coral.service#serializationexception" as reply in postman & in test console in api gateway trying post record directly dynamodb using api proxy services.. referring aws article - https://aws.amazon.com/blogs/compute/using-amazon-api-gateway-as-a-proxy-for-dynamodb/ here's mapping { "tablename": "tablenamegoeshere", "item": { "id" : "$context.requestid" "eventname" : "$input.path('$.eventname')", "timestamp" : $input.path('$.timestamp'), "answers": "$util.parsejson($input.path('$.answers'))" } } update: did asked ... , worked if try add array of json objects gives me above same error - here's trying now. please - couldnt find on google well #set($inputroot = $input.path('$')) { "tablename": "answer", "item": {
Read more

asp.net - Problems sending emails from forum -

i have been redesigning site has message board, has been written guy looked after site. it has few problems , written in .asp , uses .mdb files database. you can see whole thing here . feel free post if helps, test thing have set using original files , new database. the basic problem when posts message, supposed email sent them, have posted it. when replies, originator supposed message, replier has been posted. i’d have thought @ point in process there should script/file in postmessage.asp? the postmessage.asp page below. <% option explicit %> <!-- #include virtual="common/adovbs.inc" --> <html> <head> <meta http-equiv="content-type" content="text/html; charset=windows-1252"> <meta name="generator" content="microsoft frontpage 4.0"> <meta name="progid" content="frontpage.editor.document"> <title>new page 2</title> <base target="_self"
Read more