How to send a job/http request in Java(with json) to a webservice which has a submit button? -


i want send http request java programm netmhc webservice results part of pipeline. put sequence json object , try send netmhc service. , start job have click submit button on website. instead of result this, http://www.cbs.dtu.dk/cgi-bin/webface2.fcgi?jobid=5824785e00001e9d3b38e362&wait=20, returns html website of netmhc. how can add submit command json object start job/http request?

jsonobject obj = new jsonobject(); obj.put("seqpaste", "maalpgtvprmmrpapgqnyprtgfnhirhkiv"); // <textarea name="seqpaste" rows=8 cols=64></textarea> obj.put("len",9);//<select multiple name=len><option value=9>9mer peptides   //add submit button json   //<input type="submit" value="submit">  try (closeablehttpclient httpclient = httpclientbuilder.create().build()) {     httppost request = new httppost("http://www.cbs.dtu.dk/services/netmhc/");      stringentity entity = new stringentity(obj.tojsonstring());     request.addheader("content-type", "application/json");               request.setentity(entity);     httpresponse response = httpclient.execute(request);      string jsonresp = entityutils.tostring(response.getentity(), "utf-8");     system.out.println(jsonresp);  } catch (ioexception ex) {     ex.printstacktrace(); } 

are there alternative ways send request webserver has submit button? far tried cgi, turned out have no permission. considered soap, struggeling create correct soap body fits query. have advice me? many in advance


Comments

Popular posts from this blog

sql server - Cannot query correctly (MSSQL - PHP - JSON) -

C++ Linked List -